PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25993s0113.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 599aa    MW: 66976.1 Da    PI: 7.2782
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25993s0113.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.8e-23125225198
                           EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                           f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF  
  Bostr.25993s0113.1.p 125 FVKILTASDTSTHGGFSVLRKHATEClpsldMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL- 212
                           89****************************9666677789************************************************. PP

                           -SSSEE..EEEEE- CS
                    B3  85 dgrsefelvvkvfr 98 
                            + +++ l+v+v+r
  Bostr.25993s0113.1.p 213 -RGETGDLRVGVRR 225
                           .3489999***998 PP

2Auxin_resp97.12.7e-32251330183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+ha++tks+F v+Y+Pr   s+F+++v+k++ a+k+ +s+GmRf+m+fe+e+s+er ++Gt++g  dl++ +Wp SkWrsL+
  Bostr.25993s0113.1.p 251 ASHAVNTKSIFIVLYKPRI--SQFIISVNKYMVAIKHGFSLGMRFRMRFEGEESPERIFTGTIIGSGDLSS-QWPASKWRSLQ 330
                           789***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.88E-39110254IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.3E-38119240IPR015300DNA-binding pseudobarrel domain
CDDcd100175.93E-20124225No hitNo description
PROSITE profilePS5086312.125125227IPR003340B3 DNA binding domain
PfamPF023622.3E-21125225IPR003340B3 DNA binding domain
SMARTSM010192.3E-21125227IPR003340B3 DNA binding domain
PfamPF065072.9E-29251330IPR010525Auxin response factor
PfamPF023091.4E-8469531IPR033389AUX/IAA domain
SuperFamilySSF542776.54E-14491571No hitNo description
PROSITE profilePS5174527.038495587IPR000270PB1 domain
PfamPF023091.0E-6541580IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MANVVDADFR RSGSNDDQLY TELWKACAGP LVEVPRYNER VFYFPQGHME QLVASTNQGV  60
VDQEIPVFNL PPKILCRVLS VLLKAEHETD EVYAQITLQP EEDQSEPTIL DPPLVEPAKP  120
TVDSFVKILT ASDTSTHGGF SVLRKHATEC LPSLDMTQPT PTQELVARDL HGYEWRFKHI  180
FRGQPRRHLL TTGWSTFVTS KRLVAGDAFV FLRGETGDLR VGVRRLARQQ STMPASVISS  240
QSMRLGVLAT ASHAVNTKSI FIVLYKPRIS QFIISVNKYM VAIKHGFSLG MRFRMRFEGE  300
ESPERIFTGT IIGSGDLSSQ WPASKWRSLQ IQWDEPSSIK RPNKVSPWEI EPFSPSALTP  360
TLTQPQSKSK RSRPIDSSIS EITGSPVASN FLSSFSQSHE SNPLVKLLFN DPATERNLNK  420
SVFSSGLQGK KTEAPVTSCC RLFGFDLTSK PASAPIPPDK QLISLYSNNS DSTTKCQDPK  480
SSNSTKEQKQ QTSTRSRTKV QMRGTAVGRA VDLTLLRSYD ELIKELEKMF EIEGELSPKD  540
KWAIVFTDDE GDMMLVGDDP WDEFCKMAKK LFIYSSEEVK KMSSKSLLDD DGTIVNLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-16413541356Auxin response factor 1
4ldw_A1e-16413541356Auxin response factor 1
4ldw_B1e-16413541356Auxin response factor 1
4ldx_A1e-16413541356Auxin response factor 1
4ldx_B1e-16413541356Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2299240.0AK229924.1 Arabidopsis thaliana mRNA for ARF1 family auxin responsive transcription factor like protein, complete cds, clone: RAFL22-28-H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010506661.10.0PREDICTED: auxin response factor 11
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLR0HBF00.0R0HBF0_9BRAS; Auxin response factor
STRINGscaffold_403621.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11